RegulonDB RegulonDB 10.9: Gene Form
   

dcuS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcuS dcuB dcuR yjdI NarL NarL CRP DcuR DcuR NarL CRP FNR NarL NarL NarL NarL NarL FNR FNR FNR TSS_4927 TSS_4927 dcuSp dcuSp dcuRp dcuRp dcuBp2 dcuBp2 TSS_4925 TSS_4925 TSS_4924 TSS_4924 dcuBp dcuBp TSS_4923 (cluster) TSS_4923 (cluster)

Gene      
Name: dcuS    Texpresso search in the literature
Synonym(s): ECK4118, G7827, b4125, yjdH
Genome position(nucleotides): 4350031 <-- 4351662 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.94
External database links:  
ASAP:
ABE-0013509
ECHOBASE:
EB2358
ECOLIHUB:
dcuS
OU-MICROARRAY:
b4125
STRING:
511145.b4125
COLOMBOS: dcuS


Product      
Name: sensor histidine kinase DcuS
Synonym(s): DcuS, YjdH
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol,inner membrane
Molecular weight: 60.551
Isoelectric point: 6.722
Motif(s):
 
Type Positions Sequence
149 -> 149 F
322 -> 322 R
233 -> 233 E
435 -> 535 LITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIP
46 -> 179 DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0009365 - protein histidine kinase complex
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042802 - identical protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006468 - protein phosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
External database links:  
DIP:
DIP-9414N
ECOCYC:
DCUS-MONOMER
ECOLIWIKI:
b4125
INTERPRO:
IPR029151
INTERPRO:
IPR035965
INTERPRO:
IPR033463
INTERPRO:
IPR039506
INTERPRO:
IPR036890
INTERPRO:
IPR000014
INTERPRO:
IPR003594
INTERPRO:
IPR004358
INTERPRO:
IPR005467
INTERPRO:
IPR013767
INTERPRO:
IPR016120
MODBASE:
P0AEC8
PDB:
3BY8
PDB:
2W0N
PDB:
1OJG
PFAM:
PF17203
PFAM:
PF14689
PFAM:
PF02518
PFAM:
PF00989
PRIDE:
P0AEC8
PRINTS:
PR00344
PRODB:
PRO_000022416
PROSITE:
PS50112
PROSITE:
PS50109
REFSEQ:
NP_418549
SMART:
SM00091
SMART:
SM00387
SMR:
P0AEC8
SWISSMODEL:
P0AEC8
UNIPROT:
P0AEC8


Operon      
Name: dcuSR         
Operon arrangement:
Transcription unit        Promoter
dcuR
dcuSR


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4923 (cluster) 4347981 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4924 4348786 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4925 4348841 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4927 4351813 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB