RegulonDB RegulonDB 10.9: Gene Form
   

ytfK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ytfL ytfK ytfL5\' ytfJ PhoB PhoB ytfKp ytfKp TSS_5072 TSS_5072 ytfJp ytfJp

Gene      
Name: ytfK    Texpresso search in the literature
Synonym(s): ECK4213, G7872, b4217
Genome position(nucleotides): 4439587 --> 4439793 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.48
External database links:  
ASAP:
ABE-0013797
ECHOBASE:
EB2404
ECOLIHUB:
ytfK
OU-MICROARRAY:
b4217
STRING:
511145.b4217
COLOMBOS: ytfK


Product      
Name: stringent response modulator YtfK
Synonym(s): DUF1107 domain-containing protein YtfK, YtfK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.072
Isoelectric point: 10.789
Motif(s):
 
Type Positions Sequence
1 -> 63 MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILIPKVKDKLHLSVMSEVNRQVMRL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
biological_process GO:0006979 - response to oxidative stress
GO:0016036 - cellular response to phosphate starvation
GO:0015968 - stringent response
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7872-MONOMER
ECOLIWIKI:
b4217
INTERPRO:
IPR009491
PFAM:
PF06526
PRIDE:
P0ADE2
REFSEQ:
NP_418638
SMR:
P0ADE2
UNIPROT:
P0ADE2


Operon      
Name: ytfK         
Operon arrangement:
Transcription unit        Promoter
ytfK


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5072 4439413 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB