RegulonDB RegulonDB 10.7: Gene Form
   

idnO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

idnT idnD idnO anti-anti-terminator anti-terminator terminator TSS_5118 TSS_5118

Gene      
Name: idnO    Texpresso search in the literature
Synonym(s): ECK4259, G7892, b4266, yjgU
Genome position(nucleotides): 4492587 <-- 4493351 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.41
External database links:  
ASAP:
ABE-0013971
ECHOBASE:
EB2429
ECOO157CYC:
Z1533
OU-MICROARRAY:
b4266
PORTECO:
idnO
REGULONDB:
b4266
STRING:
511145.b4266
M3D: idnO
COLOMBOS: idnO
PortEco: b4266


Product      
Name: 5-keto-D-gluconate 5-reductase
Synonym(s): IdnO, YjgU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.563
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
10 -> 203 KNILITGSAQGIGFLLATGLGKYGAQIIINDITAERAELAVEKLHQEGIQAVAAPFNVTHKHEIDAAVEHIEKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALVEDE
13 -> 37 LITGSAQGIGFLLATGLGKYGAQII

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0008874 - gluconate 5-dehydrogenase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0046183 - L-idonate catabolic process
GO:0055114 - oxidation-reduction process
External database links:  
ECOCYC:
GLUCONREDUCT-MONOMER
ECOLIWIKI:
b4266
ECOO157CYC:
Z1533-MONOMER
INTERPRO:
IPR036291
INTERPRO:
IPR020904
INTERPRO:
IPR002347
MINT:
MINT-1231433
MODBASE:
P0A9P9
PANTHER:
PTHR24322
PFAM:
PF00106
PRIDE:
P0A9P9
PRINTS:
PR00080
PRINTS:
PR00081
PRODB:
PRO_000022995
PROSITE:
PS00061
PROTEINMODELPORTAL:
P0A9P9
REFSEQ:
NP_418687
SMR:
P0A9P9
UNIPROT:
P0A9P9


Operon      
Name: idnDOTR         
Operon arrangement:
Transcription unit        Promoter
idnR
idnDOTR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IdnR
Repressed by: GntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5118 4491570 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB