RegulonDB RegulonDB 10.7: Gene Form
   

idnD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

idnD idnO idnK GntR CRP IdnR GntR GntR CRP anti-anti-terminator anti-terminator idnKp idnKp idnDp idnDp

Gene      
Name: idnD    Texpresso search in the literature
Synonym(s): ECK4260, G7893, b4267, yjgV
Genome position(nucleotides): 4493375 <-- 4494406 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.38
External database links:  
ASAP:
ABE-0013975
ECHOBASE:
EB2430
OU-MICROARRAY:
b4267
PORTECO:
idnD
REGULONDB:
b4267
STRING:
511145.b4267
M3D: idnD
COLOMBOS: idnD
PortEco: b4267


Product      
Name: L-idonate 5-dehydrogenase
Synonym(s): IdnD, YjgV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.147
Isoelectric point: 6.275
Motif(s):
 
Type Positions Sequence
30 -> 139 TLVQITRGGICGSDLHYYQEGKVGNFMIKAPMVLGHEVIGKVIHSDSSELHEGQTVAINPSKPCGHCKYCIEHNENQCTDMRFFGSAMYFPHVDGGFTRYKMVETSQCVP
180 -> 304 PIGCLIVSAVKTLGAAEIVCADVSPRSLSLGKEMGADVLVNPQNDDMDHWKAEKGYFDVSFEVSGHPSSVNTCLEVTRARGVMVQVGMGGAMAEFPMMTLIGKEISLRGSFRFTSEFNTAVSWLA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0050572 - L-idonate 5-dehydrogenase activity
biological_process GO:0046183 - L-idonate catabolic process
GO:0019521 - D-gluconate metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10010N
ECOCYC:
IDONDEHYD-MONOMER
ECOLIWIKI:
b4267
INTERPRO:
IPR013154
INTERPRO:
IPR013149
INTERPRO:
IPR036291
INTERPRO:
IPR011032
MINT:
MINT-1242659
MODBASE:
P39346
PANTHER:
PTHR11695
PDB:
6DKH
PFAM:
PF00107
PFAM:
PF08240
PRIDE:
P39346
PRODB:
PRO_000022993
PROSITE:
PS00059
PROTEINMODELPORTAL:
P39346
REFSEQ:
NP_418688
SMR:
P39346
UNIPROT:
P39346


Operon      
Name: idnDOTR         
Operon arrangement:
Transcription unit        Promoter
idnR
idnDOTR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IdnR
Repressed by: GntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB