RegulonDB RegulonDB 10.9: Gene Form
   

nanY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjhB yjhC ythA yjhCp yjhCp yjhCp2 yjhCp2

Gene      
Name: nanY    Texpresso search in the literature
Synonym(s): ECK4270, G7901, b4280, yjhC
Genome position(nucleotides): 4505287 --> 4506405 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.7
External database links:  
ASAP:
ABE-0014027
ECHOBASE:
EB2433
ECOLIHUB:
yjhC
OU-MICROARRAY:
b4280
STRING:
511145.b4280
COLOMBOS: nanY


Product      
Name: KpLE2 phage-like element; 2,7-anhydro-N-acetylneuraminate hydratase
Synonym(s): KpLE2 phage-like element; N-acetylneuraminate dehydratase, KpLE2 phage-like element; putative sialic acid oxidoreductase YjhC, NanY, YjhC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 41.384
Isoelectric point: 6.561
Motif(s):
 
Type Positions Sequence
130 -> 362 RKLIKEGVIGEILSCHTKRNGWENKQERLSWKKMKEQSGGHLYHHIHELDCVQHLLGEIPETVTMIGGNLAHSGPGFGNEDDMLFMTLEFPSGKLATLEWGSAFNWPEHYVIINGTKGSIKIDMQETAGSLRIGGQTKHFLVHETQEEDDDRRKGNMTSEMDGAIAYGHPGKKTPLWLASLIRKETLFLHNILCGAKPEEDYIDLLNGEAAMSAIATADAATLSRSQDRKVKI
2 -> 118 INYGVVGVGYFGAELARFMNMHDNAKITCVYDPENGENIARELQCINMSSLDALVSSKLVDCVIVATPNYLHKEPVIKAAKNKKHVFCEKPIALSYEDCVDMVKACKEAGVTFMAGH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0016836 - hydro-lyase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0055114 - oxidation-reduction process
GO:0019262 - N-acetylneuraminate catabolic process
External database links:  
DIP:
DIP-12617N
ECOCYC:
G7901-MONOMER
ECOLIWIKI:
b4280
INTERPRO:
IPR000683
INTERPRO:
IPR004104
INTERPRO:
IPR036291
MODBASE:
P39353
PDB:
6O15
PFAM:
PF02894
PFAM:
PF01408
PRIDE:
P39353
REFSEQ:
NP_418700
SMR:
P39353
UNIPROT:
P39353


Operon      
Name: nanXY         
Operon arrangement:
Transcription unit        Promoter
yjhBC
yjhC
yjhC


Transcriptional Regulation      
Display Regulation             
Repressed by: NanR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB