RegulonDB RegulonDB 10.9: Gene Form
   

nanC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nanM nanC fimB fimA3\' BasR NagC IHF NagC CRP NanR NanR NanR DksA DksA-ppGpp DksA-ppGpp ppGpp fimBp1 fimBp1 TSS_5131 TSS_5131 fimBp2 fimBp2 nanCp nanCp nanSp1 nanSp1

Gene      
Name: nanC    Texpresso search in the literature
Synonym(s): ECK4302, G7921, b4311, yjhA
Genome position(nucleotides): 4538785 <-- 4539501 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.96
External database links:  
ASAP:
ABE-0014136
ECHOBASE:
EB2290
ECOLIHUB:
nanC
OU-MICROARRAY:
b4311
STRING:
511145.b4311
COLOMBOS: nanC


Product      
Name: N-acetylneuraminic acid outer membrane channel
Synonym(s): NanC, YjhA
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 27.888
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
76 -> 87 NDVQVEVNYAIK
204 -> 212 ITPYIEYDY
22 -> 236 QAATLDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESNTWNTIHDNKKENAALNDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDYRYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSF
92 -> 102 WTVRPGMLTHF
1 -> 23 MKKAKILSGVLLLCFSSPLISQA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0045203 - integral component of cell outer membrane
GO:0046930 - pore complex
molecular_function GO:0015288 - porin activity
GO:0015136 - sialic acid transmembrane transporter activity
GO:0015478 - oligosaccharide transporting porin activity
biological_process GO:0006811 - ion transport
GO:0008643 - carbohydrate transport
GO:0015739 - sialic acid transport
GO:0055085 - transmembrane transport
GO:0015772 - oligosaccharide transport
Note(s): Note(s): ...[more].
Reference(s): [1] El-Labany S., et al., 2003
External database links:  
ECOCYC:
G7921-MONOMER
ECOLIWIKI:
b4311
INTERPRO:
IPR009331
PANTHER:
PTHR38105
PDB:
2WJQ
PDB:
2WJR
PFAM:
PF06178
PRIDE:
P69856
REFSEQ:
NP_418731
SMR:
P69856
UNIPROT:
P69856


Operon      
Name: nanCMS         
Operon arrangement:
Transcription unit        Promoter
nanCM
nanCMS
nanS
yjhA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: NagC, NanR


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nanSp1 4537703 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_5131 4540686 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] El-Labany S., Sohanpal BK., Lahooti M., Akerman R., Blomfield IC., 2003, Distant cis-active sequences and sialic acid control the expression of fimB in Escherichia coli K-12., Mol Microbiol 49(4):1109-18

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB