RegulonDB RegulonDB 10.8: Gene Form
   

hypT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

iadA hypT iraD idlP hypTp4 hypTp4

Gene      
Name: hypT    Texpresso search in the literature
Synonym(s): ECK4318, G7924, b4327, qseD, yjiE
Genome position(nucleotides): 4557378 <-- 4558289 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.32
External database links:  
ASAP:
ABE-0014192
ECHOBASE:
EB2454
OU-MICROARRAY:
b4327
PortEco:
yjiE
STRING:
511145.b4327
COLOMBOS: hypT


Product      
Name: DNA-binding transcriptional dual regulator HypT
Synonym(s): HypT, QseD, YjiE
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 34.711
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
99 -> 297 AQRKIKIAAAHSLSLGLLPSIISQMPPLFTWAIEAIDVDEAVDKLREGQSDCIFSFHDEDLLEAPFDHIRLFESQLFPVCASDEHGEALFNLAQPHFPLLNYSRNSYMGRLINRTLTRHSELSFSTFFVSSMSELLKQVALDGCGIAWLPEYAIQQEIRSGKLVVLNRDELVIPIQAYAYRMNTRMNPVAERFWRELRE
28 -> 47 FSQAAVSRNVSQPAFSRRIR
11 -> 68 IETKWLYDFLTLEKCRNFSQAAVSRNVSQPAFSRRIRALEQAIGVELFNRQVTPLQLS
16 -> 71 LYDFLTLEKCRNFSQAAVSRNVSQPAFSRRIRALEQAIGVELFNRQVTPLQLSEQG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042802 - identical protein binding
GO:0044212 - transcription regulatory region DNA binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001017 - bacterial-type RNA polymerase regulatory region DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-12633N
ECOCYC:
G7924-MONOMER
ECOLIWIKI:
b4327
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MODBASE:
P39376
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P39376
PRINTS:
PR00039
PROSITE:
PS50931
REFSEQ:
NP_418747
SMR:
P39376
UNIPROT:
P39376


Operon      
Name: hypT         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hypTp4 4558317 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB