RegulonDB RegulonDB 10.8: Gene Form
   

iadA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

iadA hypT yjiG iraD yjiH iadAp3 iadAp3 hypTp4 hypTp4

Gene      
Name: iadA    Texpresso search in the literature
Synonym(s): ECK4319, G7925, b4328, yjiF
Genome position(nucleotides): 4558354 <-- 4559526 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.61
External database links:  
ASAP:
ABE-0014195
ECHOBASE:
EB2455
OU-MICROARRAY:
b4328
PortEco:
iadA
STRING:
511145.b4328
COLOMBOS: iadA


Product      
Name: isoaspartyl dipeptidase
Synonym(s): IadA, YjiF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.084
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
264 -> 374 AEGIARAVQAGIPLARVTLSSDGNGSQPFFDDEGNLTHIGVAGFETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTGKGEILPGNDADLLVMTPELRIEQVYARGKL
75 -> 77 GGE
233 -> 233 R
285 -> 285 D
77 -> 77 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0008270 - zinc ion binding
GO:0016812 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
GO:0008237 - metallopeptidase activity
GO:0042802 - identical protein binding
GO:0008798 - beta-aspartyl-peptidase activity
biological_process GO:0006508 - proteolysis
External database links:  
DIP:
DIP-10001N
ECOCYC:
G7925-MONOMER
ECOLIWIKI:
b4328
INTERPRO:
IPR010229
INTERPRO:
IPR006680
INTERPRO:
IPR011059
INTERPRO:
IPR032466
INTERPRO:
IPR033826
MODBASE:
P39377
PANTHER:
PTHR11647:SF77
PDB:
2AQV
PDB:
2AQO
PDB:
1YBQ
PDB:
1POK
PDB:
1POJ
PDB:
1PO9
PDB:
1ONX
PDB:
1ONW
PDB:
5LP3
PFAM:
PF01979
PRIDE:
P39377
PRODB:
PRO_000022980
REFSEQ:
NP_418748
SMR:
P39377
UNIPROT:
P39377


Operon      
Name: yjiHG-iadA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hypTp4 4558317 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter iadAp3 4559537 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB