RegulonDB RegulonDB 10.8: Gene Form
   

yjiG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

iadA yjiH kptA yjiG iadAp3 iadAp3

Gene      
Name: yjiG    Texpresso search in the literature
Synonym(s): ECK4320, G7926, b4329
Genome position(nucleotides): 4559539 <-- 4560000 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.25
External database links:  
ASAP:
ABE-0014197
ECHOBASE:
EB2456
OU-MICROARRAY:
b4329
PortEco:
yjiG
STRING:
511145.b4329
COLOMBOS: yjiG


Product      
Name: Gate family protein YjiG
Synonym(s): YjiG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.193
Isoelectric point: 7.439
Motif(s):
 
Type Positions Sequence
69 -> 89 ATVLLAALMSMGGAVGVAASL
133 -> 153 HIITVCVINALLSIWVMQLIV
27 -> 90 NLLPNVVMAFVIIQALKITGLLDWVGHICEPVMALWGLPGEAATVLLAALMSMGGAVGVAASLA
90 -> 110 ATAGALTGHDVTVLLPAMYLM
32 -> 52 VVMAFVIIQALKITGLLDWVG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7926-MONOMER
ECOLIWIKI:
b4329
INTERPRO:
IPR011642
PFAM:
PF07670
PRIDE:
P0AEH8
REFSEQ:
NP_418749
SMR:
P0AEH8
UNIPROT:
P0AEH8


Operon      
Name: yjiHG-iadA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter iadAp3 4559537 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB