RegulonDB RegulonDB 10.8: Gene Form
   

yjiH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

iadA yjiH kptA yjiG iadAp3 iadAp3

Gene      
Name: yjiH    Texpresso search in the literature
Synonym(s): ECK4321, G7927, b4330
Genome position(nucleotides): 4559997 <-- 4560680 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0014201
ECHOBASE:
EB2457
OU-MICROARRAY:
b4330
PortEco:
yjiH
STRING:
511145.b4330
COLOMBOS: yjiH


Product      
Name: Gate family protein YjiH
Synonym(s): YjiH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.793
Isoelectric point: 4.876
Motif(s):
 
Type Positions Sequence
79 -> 99 GFLFALELAPSVILSLGIISI
17 -> 37 VGIKGYLAFFLTIIFFSGVFS
181 -> 201 VAVFAFLGTSVIVPLAVILVF
85 -> 178 ELAPSVILSLGIISITDGLGGLRAAQQLMTPVLKPLLGIPGICSLALIANLQNTDAAAGMTKELAQEGEITERDKVIFAAYQTSGSAIITNYFS
112 -> 132 LMTPVLKPLLGIPGICSLALI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7927-MONOMER
ECOLIWIKI:
b4330
INTERPRO:
IPR011642
PFAM:
PF07670
PRIDE:
P39379
REFSEQ:
NP_418750
UNIPROT:
P39379


Operon      
Name: yjiHG-iadA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter iadAp3 4559537 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB