RegulonDB RegulonDB 10.8: Gene Form
   

kptA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiJ yjiH kptA yjiG

Gene      
Name: kptA    Texpresso search in the literature
Synonym(s): ECK4322, G7928, b4331, yjiI
Genome position(nucleotides): 4560930 --> 4561484 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.81
External database links:  
ASAP:
ABE-0014204
ECHOBASE:
EB2458
OU-MICROARRAY:
b4331
PortEco:
kptA
STRING:
511145.b4331
COLOMBOS: kptA


Product      
Name: RNA 2'-phosphotransferase
Synonym(s): KptA, YjiI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.53
Isoelectric point: 9.882
Motif(s):
 
Type Positions Sequence
11 -> 175 DTSKFLSFVLRHKPEAIGIVLDREGWADIDKLILCAQKAGKRLTRALLDTVVATSDKKRFSYSSDGRCIRAVQGHSTSQVAISFAEKTPPQFLYHGTASRFLDEIKKQGLIAGERHYVHLSADEATARKVGARHGSPVILTVKAQEMAKRGLPFWQAENGVWLTS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
biological_process GO:0006388 - tRNA splicing, via endonucleolytic cleavage and ligation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Spinelli SL., et al., 1999
[2] Steiger MA., et al., 2001
External database links:  
ECOCYC:
G7928-MONOMER
ECOLIWIKI:
b4331
INTERPRO:
IPR022928
INTERPRO:
IPR042081
INTERPRO:
IPR042080
INTERPRO:
IPR002745
PANTHER:
PTHR12684
PFAM:
PF01885
PRIDE:
P39380
PRODB:
PRO_000023067
REFSEQ:
NP_418751
SMR:
P39380
UNIPROT:
P39380


Operon      
Name: kptA         
Operon arrangement:
Transcription unit        Promoter
kptA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Spinelli SL., Kierzek R., Turner DH., Phizicky EM., 1999, Transient ADP-ribosylation of a 2'-phosphate implicated in its removal from ligated tRNA during splicing in yeast., J Biol Chem 274(5):2637-44

 [2] Steiger MA., Kierzek R., Turner DH., Phizicky EM., 2001, Substrate recognition by a yeast 2'-phosphotransferase involved in tRNA splicing and by its Escherichia coli homolog., Biochemistry 40(46):14098-105


RegulonDB