RegulonDB RegulonDB 10.8: Gene Form
   

yjiM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiN yjiM yjiL nc6 TSS_5145 (cluster) TSS_5145 (cluster) yjiLp3 yjiLp3 yjiLp2 yjiLp2

Gene      
Name: yjiM    Texpresso search in the literature
Synonym(s): ECK4326, G7932, b4335
Genome position(nucleotides): 4564699 <-- 4565850 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.56
External database links:  
ASAP:
ABE-0014214
ECHOBASE:
EB2462
OU-MICROARRAY:
b4335
PortEco:
yjiM
STRING:
511145.b4335
COLOMBOS: yjiM


Product      
Name: putative dehydratase subunit
Synonym(s): YjiM
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 42.743
Isoelectric point: 4.787
Motif(s):
 
Type Positions Sequence
40 -> 383 CTFMPQEIPMAAGAVVVSLCSTSDETIEEAEKDLPRNLCPLIKSSYGFGKTDKCPYFYFSDLVVGETTCDGKKKMYEYMAEFKPVHVMQLPNSVKDDASRALWKAEMLRLQKTVEERFGHEISEDALRDAIALKNRERRALANFYHLGQLNPPALSGSDILKVVYGATFRFDKEALINELDAMTARVRQQWEEGQRLDPRPRILITGCPIGGAAEKVVRAIEENGGWVVGYENCTGAKATEQCVAETGDVYDALADKYLAIGCSCVSPNDQRLKMLSQMVEEYQVDGVVDVILQACHTYAVESLAIKRHVRQQHNIPYIAIETDYSTSDVGQLSTRVAAFIEML

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
molecular_function GO:0016829 - lyase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12639N
ECOCYC:
G7932-MONOMER
ECOLIWIKI:
b4335
INTERPRO:
IPR010327
PFAM:
PF06050
PRIDE:
P39384
REFSEQ:
NP_418755
SMR:
P39384
UNIPROT:
P39384


Operon      
Name: yjiML         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiLp2 4564793 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjiLp3 4564802 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_5145 (cluster) 4565889 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB