RegulonDB RegulonDB 10.8: Gene Form
   

yjiS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiT yjiR yjiS terminator terminator TSS_5147 TSS_5147 yjiSp4 yjiSp4 yjiSp3 yjiSp3

Gene      
Name: yjiS    Texpresso search in the literature
Synonym(s): ECK4332, G7937, b4341
Genome position(nucleotides): 4571751 --> 4571915 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.76
External database links:  
ASAP:
ABE-0014236
ECHOBASE:
EB2467
OU-MICROARRAY:
b4341
PortEco:
yjiS
STRING:
511145.b4341
COLOMBOS: yjiS


Product      
Name: DUF1127 domain-containing protein YjiS
Synonym(s): YjiS
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 6.709
Isoelectric point: 11.652
Motif(s):
 
Type Positions Sequence
18 -> 54 LWQAVRRWRRQMQTRRVLQQMSDERLKDIGLRREDVE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7937-MONOMER
ECOLIWIKI:
b4341
INTERPRO:
IPR009506
PFAM:
PF06568
PRIDE:
P39390
REFSEQ:
NP_418761
UNIPROT:
P39390


Operon      
Name: yjiS         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiSp3 4571705 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjiSp4 4571720 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_5147 4572362 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB