RegulonDB RegulonDB 10.8: Gene Form
   

symE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hsdS mcrB symE symR hsdM LexA symEp symEp symRp symRp mcrCp5 mcrCp5

Gene      
Name: symE    Texpresso search in the literature
Synonym(s): ECK4337, G7940, b4347, dinL, sosC, yjiW
Genome position(nucleotides): 4579499 <-- 4579840 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0014253
ECHOBASE:
EB2470
OU-MICROARRAY:
b4347
PortEco:
symE
STRING:
511145.b4347
COLOMBOS: symE


Product      
Name: toxic protein SymE
Synonym(s): DinL, SosC, SymE, YjiW, toxin-like protein of the SOS response
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.203
Isoelectric point: 8.726
Motif(s):
 
Type Positions Sequence
20 -> 71 NRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTA
29 -> 74 SRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0016788 - hydrolase activity, acting on ester bonds
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
biological_process GO:0016070 - RNA metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0006402 - mRNA catabolic process
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kawano M., et al., 2007
[2] Kawano M., et al., 2005
[3] Ross TK., et al., 1987
External database links:  
ECOCYC:
G7940-MONOMER
ECOLIWIKI:
b4347
INTERPRO:
IPR014944
INTERPRO:
IPR020883
INTERPRO:
IPR007159
PFAM:
PF08845
PRIDE:
P39394
PRODB:
PRO_000024019
PROSITE:
PS51740
REFSEQ:
NP_418767
SMR:
P39394
UNIPROT:
P39394


Operon      
Name: symE         
Operon arrangement:
Transcription unit        Promoter
symE


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Regulation by small RNA    
  Display Regulation
small RNA symR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mcrCp5 4578062 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kawano M., Aravind L., Storz G., 2007, An antisense RNA controls synthesis of an SOS-induced toxin evolved from an antitoxin., Mol Microbiol 64(3):738-54

 [2] Kawano M., Reynolds AA., Miranda-Rios J., Storz G., 2005, Detection of 5'- and 3'-UTR-derived small RNAs and cis-encoded antisense RNAs in Escherichia coli., Nucleic Acids Res 33(3):1040-50

 [3] Ross TK., Braymer HD., 1987, Localization of a genetic region involved in McrB restriction by Escherichia coli K-12., J Bacteriol 169(4):1757-9

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB