RegulonDB RegulonDB 10.6.3: Gene Form
   

lgoR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lgoT lgoD lgoR CRP UxuR ExuR lgoRp4 lgoRp4 yjjLp8 yjjLp8 yjjLp6 yjjLp6 yjjLp7 yjjLp7 yjjLp5 yjjLp5

Gene      
Name: lgoR    Texpresso search in the literature
Synonym(s): ECK4347, G7944, b4357, yjjM
Genome position(nucleotides): 4594937 <-- 4595851 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.43
External database links:  
ASAP:
ABE-0014287
ECHOBASE:
EB2474
ECOCYC:
G7944
ECOLIHUB:
yjjM
OU-MICROARRAY:
b4357
REGULONDB:
b4357
STRING:
511145.b4357
M3D: lgoR
COLOMBOS: lgoR
PortEco: b4357


Product      
Name: putative DNA-binding transcriptional regulator LgoR
Synonym(s): LgoR, YjjM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.397
Isoelectric point: 7.117
Motif(s):
 
Type Positions Sequence
56 -> 56 G
31 -> 50 QSALAEMYNISRTTVRHILS
1 -> 70 MSRSQNLRHNVINQVIDDMARGHIPSPLPSQSALAEMYNISRTTVRHILSHLRECGVLTQVGNDYVIARK
159 -> 286 QLFELREMLETHSLQHFLNLPDHDPRWLQAKTMLERHRLLRDNIGNSFRMFSQLDRDFHSLLLSAADNIFFDQSLEIISVIFHFHYQWDESDLKQRNIIAVDEHMTILSALICRSDLDATLALRNHLN
26 -> 59 SPLPSQSALAEMYNISRTTVRHILSHLRECGVLT

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0019584 - galactonate catabolic process
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Perez-Rueda E., et al., 2004
[2] Reed JL., et al., 2006
External database links:  
ECOCYC:
G7944-MONOMER
ECOLIWIKI:
b4357
INTERPRO:
IPR000524
INTERPRO:
IPR036388
INTERPRO:
IPR011711
INTERPRO:
IPR008920
INTERPRO:
IPR036390
MODBASE:
P39399
PFAM:
PF00392
PFAM:
PF07729
PRIDE:
P39399
PRINTS:
PR00035
PROSITE:
PS50949
PROTEINMODELPORTAL:
P39399
REFSEQ:
YP_026290
SMART:
SM00895
SMR:
P39399
UNIPROT:
P39399


Operon      
Name: lgoR         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: ExuR, UxuR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjjLp5 4594737 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yjjLp7 4594837 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yjjLp6 4594844 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yjjLp8 4594882 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Reed JL., Patel TR., Chen KH., Joyce AR., Applebee MK., Herring CD., Bui OT., Knight EM., Fong SS., Palsson BO., 2006, Systems approach to refining genome annotation., Proc Natl Acad Sci U S A 103(46):17480-4

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB