RegulonDB RegulonDB 10.6.3: Gene Form
   

yjjQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuF yjjP yjjQ bglJ yjjB H-NS H-NS yjjQp yjjQp yjjPp yjjPp yjjBp yjjBp

Gene      
Name: yjjQ    Texpresso search in the literature
Synonym(s): ECK4355, G7947, b4365
Genome position(nucleotides): 4603477 --> 4604202 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.04
External database links:  
ASAP:
ABE-0014322
ECHOBASE:
EB2478
ECOCYC:
G7947
ECOLIHUB:
yjjQ
OU-MICROARRAY:
b4365
REGULONDB:
b4365
STRING:
511145.b4365
M3D: yjjQ
COLOMBOS: yjjQ
PortEco: b4365


Product      
Name: DNA-binding transcriptional repressor YjjQ
Synonym(s): YjjQ
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 27.032
Isoelectric point: 7.995
Motif(s):
 
Type Positions Sequence
147 -> 212 FSYRSVILTLSERKVLRLLGKGWGINQIASLLKKSNKTISAQKNSAMRRLAIHSNAEMYAWINSAQ
171 -> 190 INQIASLLKKSNKTISAQKN
153 -> 207 ILTLSERKVLRLLGKGWGINQIASLLKKSNKTISAQKNSAMRRLAIHSNAEMYAW

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0051595 - response to methylglyoxal
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IDA] Inferred from direct assay
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Kim I., et al., 2007
[2] Perez-Rueda E., et al., 2004
[3] Wiebe H., et al., 2015
External database links:  
ECOCYC:
G7947-MONOMER
ECOLIWIKI:
b4365
INTERPRO:
IPR000792
INTERPRO:
IPR016032
MODBASE:
P0ADD7
PFAM:
PF00196
PRIDE:
P0ADD7
PROSITE:
PS50043
PROTEINMODELPORTAL:
P0ADD7
REFSEQ:
NP_418785
SMART:
SM00421
SMR:
P0ADD7
UNIPROT:
P0ADD7


Operon      
Name: yjjQ-bglJ         
Operon arrangement:
Transcription unit        Promoter
yjjQ-bglJ


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kim I., Kim J., Min B., Lee C., Park C., 2007, Screening of genes related to methylglyoxal susceptibility., J Microbiol 45(4):339-43

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Wiebe H., Gurlebeck D., Gross J., Dreck K., Pannen D., Ewers C., Wieler LH., Schnetz K., 2015, YjjQ Represses Transcription of flhDC and Additional Loci in Escherichia coli., J Bacteriol 197(16):2713-20


RegulonDB