RegulonDB RegulonDB 10.8: Gene Form
   

bglJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuF yjjP yjjQ bglJ yjjB H-NS H-NS yjjQp yjjQp yjjPp yjjPp yjjBp yjjBp

Gene      
Name: bglJ    Texpresso search in the literature
Synonym(s): ECK4356, G7948, b4366, yjjR
Genome position(nucleotides): 4604160 --> 4604837 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.28
External database links:  
ASAP:
ABE-0014324
ECHOBASE:
EB2479
OU-MICROARRAY:
b4366
PortEco:
bglJ
STRING:
511145.b4366
COLOMBOS: bglJ


Product      
Name: DNA-binding transcriptional regulator BglJ
Synonym(s): BglJ, YjjR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.622
Isoelectric point: 9.897
Motif(s):
 
Type Positions Sequence
152 -> 204 TLSPTEREILRFMSRGYSMTQIAEQLKRNIKTIRAHKFNVMSKLGVSSDAGLL
170 -> 189 MTQIAEQLKRNIKTIRAHKF
146 -> 211 YINQSRTLSPTEREILRFMSRGYSMTQIAEQLKRNIKTIRAHKFNVMSKLGVSSDAGLLEAADILL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0009314 - response to radiation
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[GEA] Gene expression analysis
[IMP] Inferred from mutant phenotype
Reference(s): [1] Giel M., et al., 1996
[2] Madhusudan S., et al., 2005
[3] Perez-Rueda E., et al., 2004
[4] Sargentini NJ., et al., 2016
External database links:  
DIP:
DIP-9217N
ECOCYC:
G7948-MONOMER
ECOLIWIKI:
b4366
INTERPRO:
IPR000792
INTERPRO:
IPR016032
INTERPRO:
IPR036388
MINT:
MINT-1268192
MODBASE:
P39404
PFAM:
PF00196
PRIDE:
P39404
PRINTS:
PR00038
PRODB:
PRO_000022218
PROSITE:
PS50043
REFSEQ:
NP_418786
SMART:
SM00421
SMR:
P39404
SWISSMODEL:
P39404
UNIPROT:
P39404


Operon      
Name: yjjQ-bglJ         
Operon arrangement:
Transcription unit        Promoter
yjjQ-bglJ


Transcriptional Regulation      
Display Regulation             
Activated by: LeuO
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Giel M., Desnoyer M., Lopilato J., 1996, A mutation in a new gene, bglJ, activates the bgl operon in Escherichia coli K-12., Genetics 143(2):627-35

 [2] Madhusudan S., Paukner A., Klingen Y., Schnetz K., 2005, Independent regulation of H-NS-mediated silencing of the bgl operon at two levels: upstream by BglJ and LeuO and downstream by DnaKJ., Microbiology 151(Pt 10):3349-59

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [4] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14


RegulonDB