RegulonDB RegulonDB 10.9: Gene Form
   

fruB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fruA setB fruB fruK yeiW Cra Cra terminator TSS_2466 TSS_2466 setBp3 setBp3 setBp2 setBp2 fruBp fruBp TSS_2465 TSS_2465 TSS_2464 TSS_2464 TSS_2463 TSS_2463 TSS_2462 TSS_2462

Gene      
Name: fruB    Texpresso search in the literature
Synonym(s): ECK2162, G7990, b2169, fpr, fruF
Genome position(nucleotides): 2262365 <-- 2263495 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.53
External database links:  
ASAP:
ABE-0007180
ECHOBASE:
EB0005
ECOLIHUB:
fruB
OU-MICROARRAY:
b2169
STRING:
511145.b2169
COLOMBOS: fruB


Product      
Name: fructose-specific PTS multiphosphoryl transfer protein FruB
Synonym(s): DTP, EIIA-M-Hfru, EIIAfru, EIIIfru, Enzyme IIAfru, Enzyme IIIfru, Fpr, FruB, FruF, diphosphoryl transfer protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 39.648
Isoelectric point: 4.546
Motif(s):
 
Type Positions Sequence
2 -> 142 FQLSVQDIHPGEKAGDKEEAIRQVAAALVQAGNVAEGYVNGMLAREQQTSTFLGNGIAIPHGTTDTRDQVLKTGVQVFQFPEGVTWGDGQVAYVAIGIAASSDEHLGLLRQLTHVLSDDSVAEQLKSATTAEELRALLMGE
285 -> 375 VLSAEFVVRNEHGLHARPGTMLVNTIKQFNSDITVTNLDGTGKPANGRSLMKVVALGVKKGHRLRFTAQGADAEQALKAIGDAIAAGLGEG
5 -> 139 SVQDIHPGEKAGDKEEAIRQVAAALVQAGNVAEGYVNGMLAREQQTSTFLGNGIAIPHGTTDTRDQVLKTGVQVFQFPEGVTWGDGQVAYVAIGIAASSDEHLGLLRQLTHVLSDDSVAEQLKSATTAEELRALL
59 -> 59 A
156 -> 284 TLDIVASDLLTLQALNAARLKEAGAVDATFVTKAINEQPLNLGQGIWLSDSAEGNLRSAIAVSRAANAFDVDGETAAMLVSVAMNDDQPIAVLKRLADLLLDNKADRLLKADAATLLALLTSDDAPTDD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0019897 - extrinsic component of plasma membrane
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0022877 - protein-N(PI)-phosphohistidine-fructose phosphotransferase system transporter activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0032445 - fructose import
Note(s): Note(s): ...[more].
Reference(s): [1] Waygood EB. 1980
External database links:  
DIP:
DIP-48096N
ECOCYC:
FRUB-MONOMER
ECOLIWIKI:
b2169
INTERPRO:
IPR000032
INTERPRO:
IPR035895
INTERPRO:
IPR016152
INTERPRO:
IPR001020
INTERPRO:
IPR002114
INTERPRO:
IPR002178
MODBASE:
P69811
PFAM:
PF00381
PFAM:
PF00359
PRIDE:
P69811
PRINTS:
PR00107
PRODB:
PRO_000022700
PROSITE:
PS00369
PROSITE:
PS51350
PROSITE:
PS51094
PROSITE:
PS00589
PROSITE:
PS00372
REFSEQ:
NP_416674
SMR:
P69811
SWISSMODEL:
P69811
UNIPROT:
P69811


Operon      
Name: fruBKA         
Operon arrangement:
Transcription unit        Promoter
fruBKA


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2462 2260442 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2463 2262092 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2464 2262611 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2465 2263594 reverse nd [RS-EPT-CBR] [2]
  promoter setBp2 2263713 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter setBp3 2263836 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2466 2263839 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Waygood EB., 1980, Resolution of the phosphoenolpyruvate: fructose phosphotransferase system of Escherichia coli into two components: enzyme IIfructose and fructose-induced HPr-like protein (FPr)., Can J Biochem 58(10):1144-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB