RegulonDB RegulonDB 10.6.3: Gene Form
   

uxaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uxaA uxaC exuT CRP UxuR ExuR ExuR CRP ExuR ExuR CRP ExuR exuRp exuRp exuTp1 exuTp1 exuTp2 exuTp2 uxaCp uxaCp uxaCp1 uxaCp1 TSS_3390 TSS_3390 TSS_3389 TSS_3389

Gene      
Name: uxaC    Texpresso search in the literature
Synonym(s): ECK3083, G81, b3092, ygjX, ygjY, ygjZ
Genome position(nucleotides): 3243329 <-- 3244741 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.28
External database links:  
ASAP:
ABE-0010167
CGSC:
15
ECHOBASE:
EB2593
ECOCYC:
G81
ECOLIHUB:
uxaC
OU-MICROARRAY:
b3092
REGULONDB:
b3092
STRING:
511145.b3092
M3D: uxaC
COLOMBOS: uxaC
PortEco: b3092


Product      
Name: D-glucoronate/D-galacturonate isomerase
Synonym(s): UxaC, YgjX, YgjY, YgjZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.987
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
1 -> 465 MTPFMTEDFLLDTEFARRLYHDYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITGKLLSPSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGSFTIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHALDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDRPMAEELSKLLSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMERQMTQLAQLGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVEAGEAPADINLLGEMVKNICFNNARDYF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0008880 - glucuronate isomerase activity
biological_process GO:0006064 - glucuronate catabolic process
GO:0019698 - D-galacturonate catabolic process
GO:0042840 - D-glucuronate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Portalier RC., et al., 1974
External database links:  
ECOCYC:
UXAC-MONOMER
ECOLIWIKI:
b3092
INTERPRO:
IPR003766
INTERPRO:
IPR032466
MODBASE:
P0A8G3
PFAM:
PF02614
PRIDE:
P0A8G3
PRODB:
PRO_000024205
PROTEINMODELPORTAL:
P0A8G3
REFSEQ:
NP_417563
SMR:
P0A8G3
UNIPROT:
P0A8G3


Operon      
Name: uxaCA         
Operon arrangement:
Transcription unit        Promoter
uxaCA
uxaCA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR
Repressed by: ExuR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3389 3244779 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3390 3244787 reverse nd [RS-EPT-CBR] [2]
  promoter exuRp 3246508 forward nd [AIPP] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Portalier RC., Robert-Baudouy JM., Nemoz GM., 1974, [Studies of mutations in the uronic isomerase and altronic oxidoreductase structural genes of Escherichia coli K 12 (author's transl)], Mol Gen Genet 128(4):301-19

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Gama-Castro S., Jimenez-Jacinto V., Peralta-Gil M., Santos-Zavaleta A., Penaloza-Spinola MI., Contreras-Moreira B., Segura-Salazar J., Muniz-Rascado L., Martinez-Flores I., Salgado H., Bonavides-Martinez C., Abreu-Goodger C., Rodriguez-Penagos C., Miranda-Rios J., Morett E., Merino E., Huerta AM., Trevino-Quintanilla L., Collado-Vides J., 2008, RegulonDB (version 6.0): gene regulation model of Escherichia coli K-12 beyond transcription, active (experimental) annotated promoters and Textpresso navigation., Nucleic Acids Res 36(Database issue):D120-4


RegulonDB