RegulonDB RegulonDB 10.8: Gene Form
   

yaaI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaK yaaW mbiA yaaI TSS_38 TSS_38 TSS_37 TSS_37 TSS_36 TSS_36 TSS_35 (cluster) TSS_35 (cluster) TSS_34 TSS_34 TSS_33 TSS_33 TSS_32 (cluster) TSS_32 (cluster) TSS_31 (cluster) TSS_31 (cluster) TSS_30 TSS_30 TSS_29 TSS_29 TSS_28 TSS_28 dnaKp3 dnaKp3 TSS_27 TSS_27 dnaKp2 dnaKp2 dnaKp1 dnaKp1 yaaIp2 yaaIp2 yaaIp3 yaaIp3 yaaIp4 yaaIp4 yaaWp3 yaaWp3

Gene      
Name: yaaI    Texpresso search in the literature
Synonym(s): ECK0013, G8202, b0013
Genome position(nucleotides): 11382 <-- 11786 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.89
External database links:  
ASAP:
ABE-0000043
ECHOBASE:
EB1475
OU-MICROARRAY:
b0013
PortEco:
yaaI
STRING:
511145.b0013
COLOMBOS: yaaI


Product      
Name: DUF2541 domain-containing protein YaaI
Synonym(s): YaaI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 14.482
Isoelectric point: 7.966
Motif(s):
 
Type Positions Sequence
3 -> 132 SVFTISASLAISLMLCCTAQANDHKLLGAIAMPRNETNDLALKLPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDNDNKRCVSKITFSGHTVNSSDMATLKIIG
1 -> 23 MKSVFTISASLAISLMLCCTAQA
24 -> 134 NDHKLLGAIAMPRNETNDLALKLPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDNDNKRCVSKITFSGHTVNSSDMATLKIIGDD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G8202-MONOMER
ECOLIWIKI:
b0013
INTERPRO:
IPR020240
PFAM:
PF10807
PRIDE:
P28696
PRODOM:
PD082838
REFSEQ:
NP_414554
UNIPROT:
P28696


Operon      
Name: yaaI         
Operon arrangement:
Transcription unit        Promoter
yaaI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaaWp3 11542 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaaIp4 11825 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaaIp3 11913 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaaIp2 11938 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_27 12142 forward nd [RS-EPT-CBR] [3]
  promoter TSS_28 12891 forward nd [RS-EPT-CBR] [3]
  promoter TSS_29 13044 forward nd [RS-EPT-CBR] [3]
  promoter TSS_30 13046 forward nd [RS-EPT-CBR] [3]
  promoter TSS_31 (cluster) 13048 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_32 (cluster) 13052 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_33 13058 forward nd [RS-EPT-CBR] [3]
  promoter TSS_34 13064 forward nd [RS-EPT-CBR] [3]
  promoter TSS_35 (cluster) 13082 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_36 13111 forward nd [RS-EPT-CBR] [3]
  promoter TSS_37 13127 forward nd [RS-EPT-CBR] [3]
  promoter TSS_38 13129 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB