RegulonDB RegulonDB 10.6.3: Gene Form
   

dgoD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgoT dgoD dgoK dgoA cbrA dgoR terminator

Gene      
Name: dgoD    Texpresso search in the literature
Synonym(s): ECK3684, GB4478, b3692, b4478, yidU
Genome position(nucleotides): 3871850 <-- 3872998 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.83
External database links:  
ASAP:
ABE-0174106
CGSC:
859
ECHOBASE:
EB4309
ECOCYC:
GB4478
ECOLIHUB:
dgoD
OU-MICROARRAY:
b3692
REGULONDB:
b4478
STRING:
511145.b4478
M3D: dgoD
COLOMBOS: dgoD
PortEco: b3692


Product      
Name: D-galactonate dehydratase
Synonym(s): DgoD, YidU
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 42.523
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
185 -> 185 H
310 -> 310 E
15 -> 107 WMFLKIETDEGVVGWGEPVIEGRARTVEAAVHELGDYLIGQDPSRINDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMG
135 -> 355 LREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSRFDFKRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLHIDFVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEA
285 -> 285 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0008869 - galactonate dehydratase activity
GO:0000287 - magnesium ion binding
biological_process GO:0009063 - cellular amino acid catabolic process
GO:0034194 - D-galactonate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GALACTONATE-DEHYDRATASE-MONOMER
ECOLIWIKI:
b4478
INTERPRO:
IPR029065
INTERPRO:
IPR036849
INTERPRO:
IPR034593
INTERPRO:
IPR029017
INTERPRO:
IPR023592
INTERPRO:
IPR018110
INTERPRO:
IPR013342
INTERPRO:
IPR013341
MODBASE:
Q6BF17
PANTHER:
PTHR43287
PFAM:
PF13378
PFAM:
PF02746
PRIDE:
Q6BF17
PRODB:
PRO_000022434
PROSITE:
PS00908
PROSITE:
PS00909
PROTEINMODELPORTAL:
Q6BF17
REFSEQ:
YP_026237
SMART:
SM00922
SMR:
Q6BF17
UNIPROT:
Q6BF17


Operon      
Name: dgoRKADT         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: DgoR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB