RegulonDB RegulonDB 10.9: Gene Form
   

rpe gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trpS dam gph rpe TSS_3986 TSS_3986 TSS_3985 TSS_3985 rpep rpep TSS_3984 TSS_3984 TSS_3983 (cluster) TSS_3983 (cluster) trpSp trpSp TSS_3981 (cluster) TSS_3981 (cluster) TSS_3980 TSS_3980 TSS_3979 TSS_3979

Gene      
Name: rpe    Texpresso search in the literature
Synonym(s): ECK3373, M004, b3386, dod, yhfD
Genome position(nucleotides): 3514382 <-- 3515059 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.03
External database links:  
ASAP:
ABE-0011061
ECHOBASE:
EB1903
ECOLIHUB:
rpe
OU-MICROARRAY:
b3386
STRING:
511145.b3386
COLOMBOS: rpe


Product      
Name: ribulose-phosphate 3-epimerase
Synonym(s): Dod, Rpe, YhfD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.554
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
199 -> 200 GS
177 -> 179 DGG
6 -> 203 IAPSILSADFARLGEDTAKALAAGADVVHFDVMDNHYVPNLTIGPMVLKSLRNYGITAPIDVHLMVKPVDRIVPDFAAAGASIITFHPEASEHVDRTLQLIKENGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPQTLDKLREVRRRIDESGFDIRLEVDGGVKVNNIGEIAAAGADMFVAGSAIF
203 -> 225 FDQPDYKKVIDEMRSELAKVSHE
144 -> 147 GFGG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.3 - non-oxidative branch, pentose pathway
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016857 - racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0004750 - ribulose-phosphate 3-epimerase activity
GO:0008198 - ferrous iron binding
biological_process GO:0044262 - cellular carbohydrate metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0009052 - pentose-phosphate shunt, non-oxidative branch
GO:0019323 - pentose catabolic process
GO:0006098 - pentose-phosphate shunt
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47869N
ECOCYC:
RIBULP3EPIM-MONOMER
ECOLIWIKI:
b3386
INTERPRO:
IPR000056
INTERPRO:
IPR026019
INTERPRO:
IPR013785
INTERPRO:
IPR011060
MODBASE:
P0AG07
PANTHER:
PTHR11749
PFAM:
PF00834
PRIDE:
P0AG07
PROSITE:
PS01086
PROSITE:
PS01085
REFSEQ:
NP_417845
SMR:
P0AG07
SWISSMODEL:
P0AG07
UNIPROT:
P0AG07


Operon      
Name: aroKB-damX-dam-rpe-gph-trpS         
Operon arrangement:
Transcription unit        Promoter
trpS
rpe-gph-trpS
dam-rpe-gph-trpS
dam-rpe-gph-trpS
damX-dam-rpe-gph-trpS
aroKB-damX-dam-rpe-gph-trpS
aroKB-damX-dam-rpe-gph-trpS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3979 3513300 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3980 3513339 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3981 (cluster) 3513403 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3983 (cluster) 3513751 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3984 3515139 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3985 3515154 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3986 3515191 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB