RegulonDB RegulonDB 10.8: Gene Form
   

ruvA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ruvB ruvA yobI LexA LexA LexA LexA yebBp2 yebBp2 yebBp1 yebBp1 ruvAp1 ruvAp1 ruvAp2 ruvAp2 TSS_2211 TSS_2211 ruvBp4 ruvBp4 ruvBp3 ruvBp3 ruvBp1 ruvBp1

Gene      
Name: ruvA    Texpresso search in the literature
Synonym(s): ECK1862, b1861
Genome position(nucleotides): 1945365 <-- 1945976 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.27
External database links:  
ASAP:
ABE-0006206
CGSC:
17923
ECHOBASE:
EB0916
OU-MICROARRAY:
b1861
PortEco:
ruvA
STRING:
511145.b1861
COLOMBOS: ruvA


Product      
Name: Holliday junction branch migration complex subunit RuvA
Synonym(s): RuvA, branch migration of Holliday structures, repair
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.086
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence
72 -> 130 FKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKD
159 -> 201 AEQEAVAALVALGYKPQEASRMVSKIARPDASSETLIREALRA
1 -> 62 MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLLYG
166 -> 166 A

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009379 - Holliday junction helicase complex
GO:0048476 - Holliday junction resolvase complex
molecular_function GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0009378 - four-way junction helicase activity
GO:0042802 - identical protein binding
GO:0000400 - four-way junction DNA binding
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0009314 - response to radiation
GO:0032508 - DNA duplex unwinding
GO:0000725 - recombinational repair
Note(s): Note(s): ...[more].
Reference(s): [1] Devaraj A., et al., 2019
[2] Hargreaves D., et al., 1999
[3] Ingleston SM., et al., 2000
[4] Kaplan DL., et al., 2006
[5] Privezentzev CV., et al., 2005
[6] Sedelnikova SE., et al., 1997
[7] Whitby MC., et al., 1996
External database links:  
DIP:
DIP-48064N
ECOCYC:
EG10923-MONOMER
ECOLIWIKI:
b1861
INTERPRO:
IPR036267
INTERPRO:
IPR013849
INTERPRO:
IPR012340
INTERPRO:
IPR011114
INTERPRO:
IPR010994
INTERPRO:
IPR003583
INTERPRO:
IPR000085
MINT:
MINT-1321234
MODBASE:
P0A809
PANTHER:
PTHR33796
PDB:
1HJP
PDB:
1D8L
PDB:
1BDX
PDB:
1CUK
PDB:
1C7Y
PFAM:
PF07499
PFAM:
PF01330
PRIDE:
P0A809
PRODB:
PRO_000023900
REFSEQ:
NP_416375
SMART:
SM00278
SMR:
P0A809
UNIPROT:
P0A809


Operon      
Name: ruvAB         
Operon arrangement:
Transcription unit        Promoter
ruvAB
ruvAB


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ruvBp1 1945366 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter ruvBp3 1945452 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter ruvBp4 1945544 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter TSS_2211 1946008 reverse nd [RS-EPT-CBR] [9]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Devaraj A., Buzzo JR., Mashburn-Warren L., Gloag ES., Novotny LA., Stoodley P., Bakaletz LO., Goodman SD., 2019, The extracellular DNA lattice of bacterial biofilms is structurally related to Holliday junction recombination intermediates., Proc Natl Acad Sci U S A 116(50):25068-25077

 [2] Hargreaves D., Rafferty JB., Sedelnikova SE., Lloyd RG., Rice DW., 1999, Crystallization of Escherichia coli RuvA complexed with a synthetic Holliday junction., Acta Crystallogr D Biol Crystallogr 55(Pt 1):263-5

 [3] Ingleston SM., Sharples GJ., Lloyd RG., 2000, The acidic pin of RuvA modulates Holliday junction binding and processing by the RuvABC resolvasome., EMBO J 19(22):6266-74

 [4] Kaplan DL., O'Donnell M., 2006, RuvA is a sliding collar that protects Holliday junctions from unwinding while promoting branch migration., J Mol Biol 355(3):473-90

 [5] Privezentzev CV., Keeley A., Sigala B., Tsaneva IR., 2005, The role of RuvA octamerization for RuvAB function in vitro and in vivo., J Biol Chem 280(5):3365-75

 [6] Sedelnikova SE., Rafferty JB., Hargreaves D., Mahdi AA., Lloyd RG., Rice DW., 1997, Crystallization of E. coli RuvA gives insights into the symmetry of a Holliday junction/protein complex., Acta Crystallogr D Biol Crystallogr 53(Pt 1):122-4

 [7] Whitby MC., Bolt EL., Chan SN., Lloyd RG., 1996, Interactions between RuvA and RuvC at Holliday junctions: inhibition of junction cleavage and formation of a RuvA-RuvC-DNA complex., J Mol Biol 264(5):878-90

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB