RegulonDB RegulonDB 10.8: Gene Form
   

ruvB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ruvB znuB ruvA znuC ruvBp4 ruvBp4 ruvBp3 ruvBp3 ruvBp1 ruvBp1

Gene      
Name: ruvB    Texpresso search in the literature
Synonym(s): ECK1861, b1860
Genome position(nucleotides): 1944346 <-- 1945356 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.72
External database links:  
ASAP:
ABE-0006204
CGSC:
17920
ECHOBASE:
EB0917
OU-MICROARRAY:
b1860
PortEco:
ruvB
STRING:
511145.b1860
COLOMBOS: ruvB


Product      
Name: Holliday junction branch migration complex subunit RuvB
Synonym(s): RuvB, branch migration of Holliday structures, repair helicase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.174
Isoelectric point: 4.787
Motif(s):
 
Type Positions Sequence
23 -> 181 IRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRL
184 -> 257 YQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVD
259 -> 328 EGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHF
62 -> 69 GPPGLGKT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0048476 - Holliday junction resolvase complex
molecular_function GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0009378 - four-way junction helicase activity
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0009411 - response to UV
GO:0032508 - DNA duplex unwinding
GO:0000725 - recombinational repair
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47870N
ECOCYC:
EG10924-MONOMER
ECOLIWIKI:
b1860
INTERPRO:
IPR008823
INTERPRO:
IPR041445
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR027417
INTERPRO:
IPR008824
INTERPRO:
IPR004605
INTERPRO:
IPR003593
MINT:
MINT-1266054
MODBASE:
P0A812
PANTHER:
PTHR42848
PFAM:
PF05491
PFAM:
PF17864
PFAM:
PF05496
PRIDE:
P0A812
PRODB:
PRO_000023901
PRODOM:
PD005323
REFSEQ:
NP_416374
SMART:
SM00382
SMR:
P0A812
SWISSMODEL:
P0A812
UNIPROT:
P0A812


Operon      
Name: ruvAB         
Operon arrangement:
Transcription unit        Promoter
ruvAB
ruvAB


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ruvBp1 1945366 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ruvBp3 1945452 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ruvBp4 1945544 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB