RegulonDB RegulonDB 10.6.3: Gene Form
   

ykgO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ykgM ykgL ykgO ykgR Zur ykgMp ykgMp

Gene      
Name: ykgO    Texpresso search in the literature
Synonym(s): ECK0295, G0-10434, b4506
Genome position(nucleotides): 312374 <-- 312514 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.84
External database links:  
ASAP:
ABE-0285027
ECHOBASE:
EB4386
ECOCYC:
G0-10434
ECOLIHUB:
ykgO
REGULONDB:
b4506
STRING:
511145.b4506
M3D: ykgO
COLOMBOS: ykgO
PortEco: ykgO


Product      
Name: putative ribosomal protein
Synonym(s): YkgO
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome
Molecular weight: 5.467
Isoelectric point: 11.974
Motif(s):
 
Type Positions Sequence
1 -> 41 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005840 - ribosome
molecular_function GO:0003735 - structural constituent of ribosome
biological_process GO:0006412 - translation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2656
ECOLIWIKI:
b4506
INTERPRO:
IPR035977
INTERPRO:
IPR000473
PANTHER:
PTHR18804
PFAM:
PF00444
PRIDE:
Q2EEQ2
PROSITE:
PS00828
PROTEINMODELPORTAL:
Q2EEQ2
REFSEQ:
YP_588437
SMR:
Q2EEQ2
UNIPROT:
Q2EEQ2


Operon      
Name: ykgMO         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Repressed by: Zur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB