RegulonDB RegulonDB 10.8: Gene Form
   

rzoD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrrD rzpD borD rzoD

Gene      
Name: rzoD    Texpresso search in the literature
Synonym(s): ECK0548, G0-10436, b4510
Genome position(nucleotides): 578327 --> 578509 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.83
External database links:  
ASAP:
ABE-0285031
ECHOBASE:
EB4123
PortEco:
rzoD
STRING:
511145.b4510
COLOMBOS: rzoD


Product      
Name: DLP12 prophage; putative prophage lysis lipoprotein RzoD
Synonym(s): RzoD
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 6.69
Isoelectric point: 10.35
Motif(s):
 
Type Positions Sequence
20 -> 60 CTSKQSVSQCVKPPRPPAWIMQPPPDWQTPLNGIISPSERG
1 -> 19 MRKLKMMLCVMMLPLVVVG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
biological_process GO:0019076 - viral release from host cell
GO:0019835 - cytolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2658
ECOLIWIKI:
b4510
INTERPRO:
IPR010346
PFAM:
PF06085
PRIDE:
P58041
PROSITE:
PS51257
REFSEQ:
YP_588440
UNIPROT:
P58041


Operon      
Name: rzoD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB