RegulonDB RegulonDB 10.8: Gene Form
   

ydaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sieB kilR unknown ydaF ydaG ydaEp5 ydaEp5

Gene      
Name: ydaF    Texpresso search in the literature
Synonym(s): ECK1352, G0-10448, b4527
Genome position(nucleotides): 1419156 <-- 1419311 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.36
External database links:  
ASAP:
ABE-0285048
ECHOBASE:
EB2077
PortEco:
ydaF
STRING:
511145.b4527
COLOMBOS: ydaF


Product      
Name: Rac prophage; DUF1391 domain-containing protein YdaF
Synonym(s): YdaF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 5.769
Isoelectric point: 9.311
Motif(s):
 
Type Positions Sequence
2 -> 49 QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT
37 -> 42 TETGAR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2670
ECOLIWIKI:
b4527
INTERPRO:
IPR009821
PFAM:
PF07151
PRIDE:
P0ACW0
PRODOM:
PD019047
REFSEQ:
NP_415872
UNIPROT:
P0ACW0


Operon      
Name: ydaGF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydaEp5 1418219 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB