RegulonDB RegulonDB 10.7: Gene Form
   

hicA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hicB yncJ unknown hicA HicB CRP hicAp2 hicAp2 hicAp1 hicAp1 TSS_1814 TSS_1814

Gene      
Name: hicA    Texpresso search in the literature
Synonym(s): ECK1431, G0-10451, b4532, yncN
Genome position(nucleotides): 1509286 --> 1509462 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.15
External database links:  
ASAP:
ABE-0285053
ECHOBASE:
EB4396
PORTECO:
hicA
REGULONDB:
b4532
STRING:
511145.b4532
M3D: hicA
COLOMBOS: hicA
PortEco: hicA


Product      
Name: toxin of the HicA-HicB toxin-antitoxin system
Synonym(s): HicA, YncN
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 6.782
Isoelectric point: 11.228
Motif(s):
 
Type Positions Sequence
4 -> 57 SEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
Gene Ontology Terms (GO)  
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0003729 - mRNA binding
GO:0004521 - endoribonuclease activity
biological_process GO:0006402 - mRNA catabolic process
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Jorgensen MG., et al., 2009
External database links:  
ECOCYC:
MONOMER0-2673
ECOLIWIKI:
b4532
INTERPRO:
IPR012933
INTERPRO:
IPR038570
PFAM:
PF07927
PRIDE:
P76106
PROTEINMODELPORTAL:
P76106
REFSEQ:
NP_415954
SMR:
P76106
UNIPROT:
P76106


Operon      
Name: hicAB         
Operon arrangement:
Transcription unit        Promoter
 
hicAB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: HicB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1814 1509035 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jorgensen MG., Pandey DP., Jaskolska M., Gerdes K., 2009, HicA of Escherichia coli defines a novel family of translation-independent mRNA interferases in bacteria and archaea., J Bacteriol 191(4):1191-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB