RegulonDB RegulonDB 10.7: Gene Form
   

ynfO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nohA ydfO ynfO stfQ Fur Fur ynfOp1 ynfOp1 nohAp nohAp

Gene      
Name: ynfO    Texpresso search in the literature
Synonym(s): ECK1542, G0-10452, b4533
Genome position(nucleotides): 1636756 --> 1636989 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.44
External database links:  
ASAP:
ABE-0285054
ECHOBASE:
EB4397
PORTECO:
ynfO
REGULONDB:
b4533
STRING:
511145.b4533
M3D: ynfO
COLOMBOS: ynfO
PortEco: ynfO


Product      
Name: Qin prophage; DUF3950 domain-containing protein YnfO
Synonym(s): YnfO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.023
Isoelectric point: 11.242
Motif(s):
 
Type Positions Sequence
21 -> 50 MIEQINIALEQKGSGNFSAWVIEACRRRLC

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2674
ECOLIWIKI:
b4533
INTERPRO:
IPR025030
PFAM:
PF13132
PRIDE:
Q2EES0
PROTEINMODELPORTAL:
Q2EES0
REFSEQ:
YP_588454
UNIPROT:
Q2EES0


Operon      
Name: ynfO-ydfO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynfOp1 1636727 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB