RegulonDB RegulonDB 10.7: Gene Form
   

yecJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftnB unknown yecJ isrB azuC yecJp4 yecJp4 TSS_2239 (cluster) TSS_2239 (cluster) TSS_2238 TSS_2238

Gene      
Name: yecJ    Texpresso search in the literature
Synonym(s): ECK1901, G0-10455, b4537
Genome position(nucleotides): 1987507 <-- 1987758 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.41
External database links:  
ASAP:
ABE-0285058
ECHOBASE:
EB3031
PORTECO:
yecJ
REGULONDB:
b4537
STRING:
511145.b4537
M3D: yecJ
COLOMBOS: yecJ
PortEco: yecJ


Product      
Name: DUF2766 domain-containing protein YecJ
Synonym(s): YecJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.123
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
1 -> 78 MSQPLNADQELVSDVVACQLVIKQILDVLDVIAPVEVREKMSSQLKNIDFTNHPAAADPVTMRAIQKAIALIELKFTP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2677
ECOLIWIKI:
b4537
INTERPRO:
IPR020262
PFAM:
PF10964
PRIDE:
P0AD10
PRODOM:
PD060536
PROTEINMODELPORTAL:
P0AD10
REFSEQ:
NP_416416
UNIPROT:
P0AD10


Operon      
Name: yecJ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2238 1987007 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2239 (cluster) 1987786 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yecJp4 1987802 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB