RegulonDB RegulonDB 10.8: Gene Form
   

yohO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehX yehW mlrA yohO yehY yohOp6 yohOp6

Gene      
Name: yohO    Texpresso search in the literature
Synonym(s): ECK2120, G0-10459, b4542
Genome position(nucleotides): 2215657 --> 2215764 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.07
External database links:  
ASAP:
ABE-0285063
ECHOBASE:
EB4403
PortEco:
yohO
STRING:
511145.b4542
COLOMBOS: yohO


Product      
Name: UPF0387 family protein YohO
Synonym(s): YohO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 3.643
Isoelectric point: 11.535
Motif(s):
 
Type Positions Sequence
2 -> 31 RIAKIGVIALFLFMALGGIGGVMLAGYTFI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2681
ECOLIWIKI:
b4542
INTERPRO:
IPR020870
PRIDE:
Q2EES6
REFSEQ:
YP_588460
UNIPROT:
Q2EES6


Operon      
Name: yohO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yohOp6 2215586 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB