RegulonDB RegulonDB 10.8: Gene Form
   

arnE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arnT arnD arnF arnE pmrD arnA

Gene      
Name: arnE    Texpresso search in the literature
Synonym(s): ECK2251, G0-10460, b4544, yfbW
Genome position(nucleotides): 2372557 --> 2372892 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.57
External database links:  
ASAP:
ABE-0285065
ECHOBASE:
EB4090
PortEco:
arnE
STRING:
511145.b4544
COLOMBOS: arnE


Product      
Name: undecaprenyl-phosphate-α-L-Ara4N flippase - ArnE subunit
Synonym(s): ArnE, YfbW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.192
Isoelectric point: 10.072
Motif(s):
 
Type Positions Sequence
3 -> 107 WLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVIL
88 -> 108 PVSPRHWCGVAFIIGGIVILG
36 -> 56 IVLWLGLALACLGLAMVLWLL
40 -> 109 LGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGS
62 -> 82 PVGIAYPMLSLNFVWVTLAAV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:1901505 - carbohydrate derivative transmembrane transporter activity
biological_process GO:0006629 - lipid metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0055085 - transmembrane transport
GO:0010041 - response to iron(III) ion
GO:1901264 - carbohydrate derivative transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2682
ECOLIWIKI:
b4544
INTERPRO:
IPR000390
INTERPRO:
IPR022883
INTERPRO:
IPR000620
PANTHER:
PTHR30561
PFAM:
PF00892
PRIDE:
Q47377
REFSEQ:
YP_588462
SMR:
Q47377
UNIPROT:
Q47377


Operon      
Name: arnBCADTEF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB