RegulonDB RegulonDB 10.8: Gene Form
   

ypeB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ligA yfeH yfeR zipA5\' ypeB yfeRp1 yfeRp1 yfeHp3 yfeHp3 TSS_2688 TSS_2688 yfeHp5 yfeHp5

Gene      
Name: ypeB    Texpresso search in the literature
Synonym(s): ECK2405, G0-10462, b4546
Genome position(nucleotides): 2527941 <-- 2528159 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.6
External database links:  
ASAP:
ABE-0285067
ECHOBASE:
EB4110
PortEco:
ypeB
STRING:
511145.b4546
COLOMBOS: ypeB


Product      
Name: PF12843 family protein YpeB
Synonym(s): YpeB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.415
Isoelectric point: 9.019
Motif(s):
 
Type Positions Sequence
3 -> 68 KEQLIEIANTIMPFGKYKGRRLIDLPEEYLLWFARKDEFPAGKLGELMQITLLIKTEGLTQLVQPL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2684
ECOLIWIKI:
b4546
INTERPRO:
IPR024530
PANTHER:
PTHR40613
PFAM:
PF12843
PRIDE:
P0AD40
PRODOM:
PD056452
REFSEQ:
YP_588464
UNIPROT:
P0AD40


Operon      
Name: ligA-ypeB         
Operon arrangement:
Transcription unit        Promoter
ligA-ypeB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfeHp5 2526909 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2688 2526926 forward nd [RS-EPT-CBR] [2]
  promoter yfeHp3 2526933 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yfeRp1 2527039 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB