RegulonDB RegulonDB 10.8: Gene Form
   

ypfN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dapE ypfH ypfN TSS_2765 TSS_2765 TSS_2764 TSS_2764 TSS_2763 TSS_2763

Gene      
Name: ypfN    Texpresso search in the literature
Synonym(s): ECK2468, G0-10463, b4547
Genome position(nucleotides): 2592762 --> 2592962 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.26
External database links:  
ASAP:
ABE-0285068
ECHOBASE:
EB4139
PortEco:
ypfN
STRING:
511145.b4547
COLOMBOS: ypfN


Product      
Name: UPF0370 protein YpfN
Synonym(s): YpfN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.071
Isoelectric point: 9.048
Motif(s):
 
Type Positions Sequence
4 -> 24 LAKYWWILVIVFLVGVLLNVI
1 -> 62 MDWLAKYWWILVIVFLVGVLLNVIKDLKRVDHKKFLANKPELPPHRDFNDKWDDDDDWPKKD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2685
ECOLIWIKI:
b4547
INTERPRO:
IPR020910
PFAM:
PF13980
PRIDE:
Q2EET2
REFSEQ:
YP_588465
SMR:
Q2EET2
UNIPROT:
Q2EET2


Operon      
Name: yffB-dapE-ypfN         
Operon arrangement:
Transcription unit        Promoter
dapE-ypfN
yffB-dapE-ypfN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2763 2592511 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2764 2592549 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2765 2592711 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB