RegulonDB RegulonDB 10.9: Gene Form
   

yifL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dapF yzcX cyaY yifL yigA yifLp yifLp TSS_4467 TSS_4467 cyaYp5 cyaYp5

Gene      
Name: yifL    Texpresso search in the literature
Synonym(s): ECK3803, G0-10471, b4558
Genome position(nucleotides): 3994522 --> 3994725 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.45
External database links:  
ASAP:
ABE-0285079
ECHOBASE:
EB2257
ECOLIHUB:
yifL
STRING:
511145.b4558
COLOMBOS: yifL


Product      
Name: putative lipoprotein YifL
Synonym(s): YifL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.177
Isoelectric point: 9.194
Motif(s):
 
Type Positions Sequence
8 -> 29 LTVLLTLFSLTGCGLKGPLYFP
20 -> 67 CGLKGPLYFPPADKNAPPPTKPVETQTQSTVPDKNDRATGDGPSQVNY
60 -> 67 DGPSQVNY
1 -> 19 MKNVFKALTVLLTLFSLTG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
MONOMER0-2693
ECOLIWIKI:
b4558
INTERPRO:
IPR032831
PFAM:
PF13627
PRIDE:
P0ADN6
PROSITE:
PS51257
REFSEQ:
YP_588473
UNIPROT:
P0ADN6


Operon      
Name: yifL-dapF-yigA-xerC-yigB         
Operon arrangement:
Transcription unit        Promoter
yifL-dapF-yigA-xerC-yigB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cyaYp5 3994083 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [2], [3]
  promoter TSS_4467 3994491 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB