RegulonDB RegulonDB 10.8: Gene Form
   

yjjZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuF yjjZ leuV OxyR Fur OxyR Fur Fur Fur OxyR OxyR yjjZp yjjZp fhuFp2 fhuFp2 fhuFp fhuFp

Gene      
Name: yjjZ    Texpresso search in the literature
Synonym(s): ECK4358, G0-10474, b4567
Genome position(nucleotides): 4605804 --> 4606040 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.1
External database links:  
ASAP:
ABE-0285088
ECHOBASE:
EB3132
PortEco:
yjjZ
STRING:
511145.b4567
COLOMBOS: yjjZ


Product      
Name: DUF1435 domain-containing protein YjjZ
Synonym(s): YjjZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.697
Isoelectric point: 9.209
Motif(s):
 
Type Positions Sequence
1 -> 75 MLQRTLGSGWGVLLPGLLIAGLMYADLSSDQWRIVILMGLVLTPMMLYHKQLRHYILLPSCLALIAGIMLMIMNL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2696
ECOLIWIKI:
b4567
INTERPRO:
IPR009885
PFAM:
PF07256
PRIDE:
P55914
PRODOM:
PD058594
REFSEQ:
YP_588478
UNIPROT:
P55914


Operon      
Name: yjjZ         
Operon arrangement:
Transcription unit        Promoter
yjjZ


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB