RegulonDB RegulonDB 10.8: Gene Form
   

insEF1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF1 eaeH insF1 ykgA insE1

Gene      
Name: insEF1    Texpresso search in the literature
Synonym(s): G0-10525
Genome position(nucleotides): 315291 --> 316453 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
ASAP:
ABE-0001028
PortEco:
insEF-1
COLOMBOS: insEF1


Product      
Name: IS3 element transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 44.967
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
152 -> 200 VLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA
226 -> 339 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Sekine Y., et al., 1994
External database links:  
ECOCYC:
MONOMER0-2748
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: eaeH-insE1EF1F1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sekine Y., Eisaki N., Ohtsubo E., 1994, Translational control in production of transposase and in transposition of insertion sequence IS3., J Mol Biol 235(5):1406-20


RegulonDB