RegulonDB RegulonDB 10.7: Gene Form
   

insEF-5 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF-5 yegS insF-5 insE-5

Gene      
Name: insEF-5    Texpresso search in the literature
Synonym(s): G0-10528
Genome position(nucleotides): 2170236 --> 2171398 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
ASAP:
ABE-0006917
PORTECO:
insEF-5
REGULONDB:
insEF-5
M3D: insEF-5
COLOMBOS: insEF-5
PortEco: insEF-5


Product      
Name: IS3 element transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 44.967
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
152 -> 200 VLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA
226 -> 339 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
MONOMER0-4249
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insE-5EF-5F-5         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2406 (cluster) 2172607 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB