RegulonDB RegulonDB 10.8: Gene Form
   

insEF3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intD insEF3 insF3 unknown peaD insE3 exoD xisD intDp6 intDp6 TSS_682 TSS_682

Gene      
Name: insEF3    Texpresso search in the literature
Synonym(s): G0-10530
Genome position(nucleotides): 566842 --> 568004 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
ASAP:
ABE-0001855
PortEco:
insEF-3
COLOMBOS: insEF3


Product      
Name: IS3 element transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 44.967
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
152 -> 200 VLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA
226 -> 339 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
MONOMER0-4247
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insE3EF3F3         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_682 566013 reverse nd [RS-EPT-CBR] [1]
  promoter intDp6 566101 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB