RegulonDB RegulonDB 10.7: Gene Form
   

insAB-1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nhaR insAB-1 insB-1 insA-1 TSS_44 (cluster) TSS_44 (cluster)

Gene      
Name: insAB-1    Texpresso search in the literature
Synonym(s): G0-10535
Genome position(nucleotides): 19811 <-- 20508 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.15
External database links:  
PORTECO:
insAB-1
REGULONDB:
insAB-1
M3D: insAB-1
COLOMBOS: insAB-1
PortEco: insAB-1


Product      
Name: InsAB' transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.388
Isoelectric point: 10.643
Motif(s):
 
Type Positions Sequence
2 -> 36 ASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCR
43 -> 86 FTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKK
102 -> 232 VIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Escoubas JM., et al., 1994
External database links:  
ECOCYC:
MONOMER0-2755
PFAM:
PF03811
PFAM:
PF12759
PFAM:
PF03400


Operon      
Name: insAB-1A-1B-1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_44 (cluster) 20342 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_45 (cluster) 20678 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_46 20910 reverse nd [RS-EPT-CBR] [2]
  transcriptional_attenuator anti-anti-terminator 20912 20935 forward nd [ICA] [3]
  transcriptional_attenuator anti-terminator 20912 20955 forward nd [ICA] [3]
  transcriptional_attenuator terminator 20937 20982 forward nd [ICA] [3]
  promoter TSS_47 21020 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_48 21045 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICA] Inferred by computational analysis



Reference(s)    

 [1] Escoubas JM., Lane D., Chandler M., 1994, Is the IS1 transposase, InsAB', the only IS1-encoded protein required for efficient transposition?, J Bacteriol 176(18):5864-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Merino E, Yanofsky C., 2005, Transcription attenuation: a highly conserved regulatory strategy used by bacteria., Trends Genet. 2005 May;21(5):260-4.


RegulonDB