RegulonDB RegulonDB 10.8: Gene Form
   

insAB2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

afuC insAB2 insB2 afuB insA2 TSS_467 (cluster) TSS_467 (cluster)

Gene      
Name: insAB2    Texpresso search in the literature
Synonym(s): G0-10537
Genome position(nucleotides): 279178 <-- 279875 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.44
External database links:  
PortEco:
insAB-2
COLOMBOS: insAB2


Product      
Name: InsAB' transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.506
Isoelectric point: 10.73
Motif(s):
 
Type Positions Sequence
2 -> 36 ASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCR
43 -> 86 FTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKK
102 -> 232 VIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVEQHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Escoubas JM., et al., 1994
External database links:  
ECOCYC:
MONOMER0-2757
PFAM:
PF03811
PFAM:
PF12759
PFAM:
PF03400


Operon      
Name: insAB2A2B2-afuBC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_467 (cluster) 279709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_468 279891 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_469 279893 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Escoubas JM., Lane D., Chandler M., 1994, Is the IS1 transposase, InsAB', the only IS1-encoded protein required for efficient transposition?, J Bacteriol 176(18):5864-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB