RegulonDB RegulonDB 10.8: Gene Form
   

insAB3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB3 insB3 insA3 ykgS TSS_472 TSS_472

Gene      
Name: insAB3    Texpresso search in the literature
Synonym(s): G0-10538
Genome position(nucleotides): 290649 <-- 291346 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.44
External database links:  
PortEco:
insAB-3
COLOMBOS: insAB3


Product      
Name: InsAB' transposase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.506
Isoelectric point: 10.73
Motif(s):
 
Type Positions Sequence
2 -> 36 ASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCR
43 -> 86 FTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKK
102 -> 232 VIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVEQHDKVIGHYLNIKHYQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
MONOMER0-4231
PFAM:
PF03811
PFAM:
PF12759
PFAM:
PF03400


Operon      
Name: insAB3A3B3         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_472 291181 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB