RegulonDB RegulonDB 10.8: Gene Form
   

insCD1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD1 insD1 yaiO insC1 anti-terminator terminator TSS_486 (cluster) TSS_486 (cluster) yaiOp5 yaiOp5 yaiOp4 yaiOp4 yaiOp6 yaiOp6

Gene      
Name: insCD1    Texpresso search in the literature
Synonym(s): G0-10541
Genome position(nucleotides): 381351 --> 382579 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.19
External database links:  
ASAP:
ABE-0001237
PortEco:
insCD-1
COLOMBOS: insCD1


Product      
Name: IS2 element transposase InsAB'
Synonym(s): InsAB'
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 46.442
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
170 -> 212 ELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL
232 -> 351 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRD

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hu ST., et al., 1996
External database links:  
ECOCYC:
MONOMER0-2761
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insC1CD1D1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiOp6 380850 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiOp4 380957 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiOp5 380973 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_486 (cluster) 381322 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hu ST., Lee LC., Lei GS., 1996, Detection of an IS2-encoded 46-kilodalton protein capable of binding terminal repeats of IS2., J Bacteriol 178(19):5652-9

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB