RegulonDB RegulonDB 10.8: Gene Form
   

insCD4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD4 insD4 ygeN pbl ygeK ygeO insC4 ygeI ygeL terminator terminator

Gene      
Name: insCD4    Texpresso search in the literature
Synonym(s): G0-10544
Genome position(nucleotides): 2996372 <-- 2997600 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.19
External database links:  
PortEco:
insCD-4
COLOMBOS: insCD4


Product      
Name: IS2 element transposase InsAB'
Synonym(s): InsAB'
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 46.442
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
170 -> 212 ELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL
232 -> 351 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRD

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4257
PFAM:
PF01527
PFAM:
PF13276
PFAM:
PF00665


Operon      
Name: insCD4C4D4-ygeON         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3142 (cluster) 2997629 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB