RegulonDB RegulonDB 10.8: Gene Form
   

sgrT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sgrR setA sgrS sgrT SgrR Cra DksA DksA ppGpp ppGpp terminator anti-terminator anti-anti-terminator sgrSp sgrSp sgrRp sgrRp

Gene      
Name: sgrT    Texpresso search in the literature
Synonym(s): ECK4477, G0-10617, b4662
Genome position(nucleotides): 77388 --> 77519 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.97
External database links:  
PortEco:
sgrT
STRING:
511145.b4662
COLOMBOS: sgrT


Product      
Name: PtsG glucose transporter inhibitor
Synonym(s): SgrT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 5.338
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence
3 -> 37 QFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0004857 - enzyme inhibitor activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0046325 - negative regulation of glucose import
GO:0043086 - negative regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Duval M., et al., 2017
[2] Kosfeld A., et al., 2012
[3] Wadler CS., et al., 2007
External database links:  
ECOCYC:
MONOMER0-2842
INTERPRO:
IPR031767
PFAM:
PF15894
PRIDE:
C1P5Z7
REFSEQ:
YP_002791237
UNIPROT:
C1P5Z7


Operon      
Name: sgrST-setA         
Operon arrangement:
Transcription unit        Promoter
sgrST-setA


Transcriptional Regulation      
Display Regulation             
Activated by: SgrR
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Duval M., Cossart P., 2017, Small bacterial and phagic proteins: an updated view on a rapidly moving field., Curr Opin Microbiol 39:81-88

 [2] Kosfeld A., Jahreis K., 2012, Characterization of the Interaction Between the Small Regulatory Peptide SgrT and the EIICBGlc of the Glucose-Phosphotransferase System of E. coli K-12., Metabolites 2(4):756-74

 [3] Wadler CS., Vanderpool CK., 2007, A dual function for a bacterial small RNA: SgrS performs base pairing-dependent regulation and encodes a functional polypeptide., Proc Natl Acad Sci U S A 104(51):20454-9


RegulonDB