RegulonDB RegulonDB 10.8: Gene Form
   

insB9 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

frsA phoE insB9 insA9 crlp2 crlp2 crlp1 crlp1

Gene      
Name: insB9    Texpresso search in the literature
Synonym(s): ECK4567, G0-16637, b4710
Genome position(nucleotides): 257923 <-- 258426 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
 54.56
External database links:  
ASAP:
 ABE-0285313
COLOMBOS: insB9


Product      
Name: IS1 transposase B
Synonym(s): InsB9
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 19.565
Isoelectric point: 10.657
Motif(s):
 
Type Positions Sequence
37 -> 167 VIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ

 
Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
 MONOMER0-4345
PFAM:
 PF03400


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter crlp1 257810 forward Zaslaver et al. demonstrated
Read more > 		[CV(RS-EPT-CBR)], [CV(TIM)], [HTIM], [IEP], [RS-EPT-CBR], [TIM] [1], [2], [3], [4]
  promoter crlp2 257824 forward This promoter was identified
Read more > 		[HIPP], [IEP] [5]


Evidence    

 [CV(RS-EPT-CBR)] cross validation(RS-EPT-CBR)

 [CV(TIM)] cross validation(TIM)

 [HTIM] High-throughput transcription initiation mapping

 [IEP] Inferred from expression pattern

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [TIM] Transcription initiation mapping

 [HIPP] Human inference of promoter position


Reference(s)    

 [1] Arnqvist A., Olsen A., Pfeifer J., Russell DG., Normark S., 1992, The Crl protein activates cryptic genes for curli formation and fibronectin binding in Escherichia coli HB101., Mol Microbiol 6(17):2443-52

 [2] Mendoza-Vargas A., Olvera L., Olvera M., Grande R., Vega-Alvarado L., Taboada B., Jimenez-Jacinto V., Salgado H., Juarez K., Contreras-Moreira B., Huerta AM., Collado-Vides J., Morett E., 2009, Genome-wide identification of transcription start sites, promoters and transcription factor binding sites in E. coli., PLoS One 4(10):e7526

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Zaslaver A., Bren A., Ronen M., Itzkovitz S., Kikoin I., Shavit S., Liebermeister W., Surette MG., Alon U., 2006, A comprehensive library of fluorescent transcriptional reporters for Escherichia coli., Nat Methods 3(8):623-8

 [5] Zhao K., Liu M., Burgess RR., 2010, Promoter and regulon analysis of nitrogen assimilation factor, sigma54, reveal alternative strategy for E. coli MG1655 flagellar biosynthesis., Nucleic Acids Res 38(4):1273-83

RegulonDB