RegulonDB RegulonDB 10.8: Gene Form
   

ytiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiK yjiL ytiA nc6 yjiKp9 yjiKp9 yjiKp7 yjiKp7 yjiKp6 yjiKp6

Gene      
Name: ytiA    Texpresso search in the literature
Synonym(s): ECK4572, G0-16640, b4715
Genome position(nucleotides): 4563668 <-- 4563925 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.71
External database links:  
ASAP:
ABE-0285711
COLOMBOS: ytiA


Product      
Name: uncharacterized protein YtiA
Synonym(s): YtiA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.556
Isoelectric point: 7.849
Motif(s):
 
Type Positions Sequence
4 -> 56 FLFLFHSTVGVIQTRKALQAAGMTFRVSDIPRDLRGGCGLCIWLTCPPGEEIQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4349
INTERPRO:
IPR021778
PFAM:
PF11823
REFSEQ:
WP_000657675
UNIPROT:
P0DN74


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiKp6 4563635 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjiKp7 4563730 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjiKp9 4563734 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB