RegulonDB RegulonDB 10.7: Gene Form
   

rzoQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rrrQ rzpQ rzoQ cspI ydfR BasR Fis Fis Fis Fis Fis Fis Cis-reg; thermoregulator cspIp cspIp cspIp2 cspIp2

Gene      
Name: rzoQ    Texpresso search in the literature
Synonym(s): ECK4503, G0-16675, b4689
Genome position(nucleotides): 1639080 <-- 1639334 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.41


Product      
Name: Qin prophage; putative lipoprotein RzoQ
Synonym(s): RzoQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 9.463
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
23 -> 84 CVPKQKNMPYALTQRSIPQILPLPSEAKQPKPPKECSPTCSEILQQKLSFMLKLLTNATSQE
1 -> 22 MRNRNLLKFLPGLLICLIVLTS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4369
PRIDE:
C1P601
PROSITE:
PS51257
REFSEQ:
YP_002791241
UNIPROT:
C1P601


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB