RegulonDB RegulonDB 10.8: Amino acid Sequence
osmotically-inducible lipoprotein OsmE Amino Acid Sequence


Size: 112

Fasta

 

>osmotically-inducible lipoprotein OsmE E. coli K12. Version NC_000913.3 GI:556503834
MNKNMAGILSAAAVLTMLAGCTAYDRTKDQFVQPVVKDVKKGMSRAQVAQIAGKPSSEVS
MIHARGTCQTYILGQRDGKAETYFVALDDTGHVINSGYQTCAEYDTDPQAAK
              
                            

Download fasta file
RegulonDB