RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF525 domain-containing protein ApaG Amino Acid Sequence


Size: 125

Fasta

 

>DUF525 domain-containing protein ApaG E. coli K12. Version NC_000913.3 GI:556503834
MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRET
EVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRLAV
PTLIH
              
                            

Download fasta file
RegulonDB